PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016461217.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 478aa    MW: 52080.1 Da    PI: 8.404
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016461217.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.7e-165599147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a+k++G   W++I +++g ++t+ q++s+ qk+
   XP_016461217.1 55 RERWTEEEHRKFLEAIKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 99
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-1649103IPR009057Homeodomain-like
PROSITE profilePS5129422.43750104IPR017930Myb domain
TIGRFAMsTIGR015572.4E-1753102IPR006447Myb domain, plants
SMARTSM007171.2E-1354102IPR001005SANT/Myb domain
PfamPF002497.9E-145598IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-105595IPR009057Homeodomain-like
CDDcd001677.61E-1157100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MASAEMADQD QSGESGVDSI RSSWNGISSD VGASSTRSIQ LKEQARKAYT ISKQRERWTE  60
EEHRKFLEAI KLYGRAWRRI EEHVGTKTAV QIRSHAQKFF SKVVRESNSG DASSVKPIEI  120
PPPRPKRKPM HPYPRKLATP VKSGTLVPEK LTRSISPNMS MSEQENQSPT SVLSAHGSDA  180
LGTGDSSKRS GSASPVSSAG GGNSDGFVLS EPPNFILQDS STPAQANAST NPENQACVKL  240
ELLPQEGSAE TSSTPCLKLF GKTVLVTESQ RPCPTSGTCK IETDVNDEAA LPTASWNIMP  300
MKFTASDSDC VSSTLTMGTP PPFYYLPSQN ENQWPTRCAS ATLLPWGSSC ASVSFPCIQV  360
LNPIPIKGRP IFNDNNLEDK QNQKEGSSTG SNTEPVSTEM SGDKNMDVEA QSSQHPLEKV  420
RKELSSRPSE TSSLVRRASS TKRIKGFVPY KRCLAERGTN SSRLSGEERE EQRTRLCM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613641.10.0PREDICTED: protein REVEILLE 1-like isoform X2
RefseqXP_016461217.10.0PREDICTED: protein REVEILLE 1-like isoform X2
TrEMBLM1BXP30.0M1BXP3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000552630.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.18e-49MYB_related family protein